NDUFV1,CI-51K
  • NDUFV1,CI-51K

Anti-NDUFV1 Antibody 25ul

Ref: AN-HPA075051-25ul
Anti-NDUFV1

Información del producto

Polyclonal Antibody against Human NDUFV1, Gene description: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, Alternative Gene Names: CI-51K, Validated applications: ICC, Uniprot ID: P49821, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NDUFV1
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
Immunogen DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-51K
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49821
HTS Code 3002150000
Gene ID 4723
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFV1 Antibody 25ul

Anti-NDUFV1 Antibody 25ul