Ver mas grande
GFAP monoclonal antibody, clone CL2713
AB-MAB15769
Producto nuevo
GFAP monoclonal antibody, clone CL2713
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | GFAP |
| Gene Alias | FLJ45472 |
| Gene Description | glial fibrillary acidic protein |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,IHC-P |
| Immunogen Prot. Seq | LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)<br>Western Blot (1:500-1:1000)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human GFAP. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 2670 |
| Clone Number | CL2713 |
| Iso type | IgG1 |
Más información
Mouse monoclonal antibody raised against partial recombinant human GFAP.