Ver mas grande
MEF2BNB monoclonal antibody (M07), clone 2H4
AB-H00729991-M07
Producto nuevo
MEF2BNB monoclonal antibody (M07), clone 2H4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MEF2BNB |
| Gene Alias | - |
| Gene Description | MEF2B neighbor |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | S-ELISA,ELISA |
| Immunogen Prot. Seq | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MEF2BNB (AAH04449.1, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 729991 |
| Clone Number | 2H4 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant MEF2BNB.