Ver mas grande
FLJ37478 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00339983-B01P
Producto nuevo
FLJ37478 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | NAT8L |
| Gene Alias | CML3|FLJ37478|Hcml3|MGC117272|NAT8-LIKE |
| Gene Description | N-acetyltransferase 8-like (GCN5-related, putative) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | FLJ37478 (NP_848652.1, 1 a.a. ~ 134 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 339983 |
Más información
Mouse polyclonal antibody raised against a full-length human FLJ37478 protein.