DNAJC5G purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

DNAJC5G purified MaxPab mouse polyclonal antibody (B01P)

AB-H00285126-B01P

Producto nuevo

DNAJC5G purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name DNAJC5G
Gene Alias CSP-gamma|FLJ40417
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNAJC5G (NP_775921, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 285126

Más información

Mouse polyclonal antibody raised against a full-length human DNAJC5G protein.

Consulta sobre un producto

DNAJC5G purified MaxPab mouse polyclonal antibody (B01P)

DNAJC5G purified MaxPab mouse polyclonal antibody (B01P)