Ver mas grande
FRMD3 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00257019-B01P
Producto nuevo
FRMD3 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | FRMD3 |
| Gene Alias | 4.1O|EPB41L4O|EPB41LO|MGC20553|P410 |
| Gene Description | FERM domain containing 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGHLLCSFSDAAYLGACIVQAELGDYDPNEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTF |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | FRMD3 (AAH41376.1, 1 a.a. ~ 581 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 257019 |
Más información
Mouse polyclonal antibody raised against a full-length human FRMD3 protein.