Ver mas grande
SFRS12 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00140890-B01P
Producto nuevo
SFRS12 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | SFRS12 |
| Gene Alias | DKFZp564B176|MGC133045|SRrp508|SRrp86 |
| Gene Description | splicing factor, arginine/serine-rich 12 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IF |
| Immunogen Prot. Seq | MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | SFRS12 (NP_631907.1, 1 a.a. ~ 508 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 140890 |
Más información
Mouse polyclonal antibody raised against a full-length human SFRS12 protein.