Ver mas grande
IL17F MaxPab rabbit polyclonal antibody (D01)
AB-H00112744-D01
Producto nuevo
IL17F MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | IL17F |
| Gene Alias | IL-17F|ML-1|ML1 |
| Gene Description | interleukin 17F |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,IP |
| Immunogen Prot. Seq | MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | IL17F (NP_443104.1, 1 a.a. ~ 163 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 112744 |
Más información
Rabbit polyclonal antibody raised against a full-length human IL17F protein.