Ver mas grande
DNER monoclonal antibody (M02), clone 2F3
AB-H00092737-M02
Producto nuevo
DNER monoclonal antibody (M02), clone 2F3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | DNER |
| Gene Alias | UNQ26|bet |
| Gene Description | delta/notch-like EGF repeat containing |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDLCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | DNER (NP_620711, 368 a.a. ~ 476 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 92737 |
| Clone Number | 2F3 |
| Iso type | IgG3 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant DNER.