Ver mas grande
LOC91614 monoclonal antibody (M01), clone 4D9
AB-H00091614-M01
Producto nuevo
LOC91614 monoclonal antibody (M01), clone 4D9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | DEPDC7 |
| Gene Alias | TR2|dJ85M6.4 |
| Gene Description | DEP domain containing 7 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | NPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LOC91614 (NP_631899, 393 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 91614 |
| Clone Number | 4D9 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant LOC91614.