Ver mas grande
MGC13096 monoclonal antibody (M01), clone 5F9
AB-H00084306-M01
Producto nuevo
MGC13096 monoclonal antibody (M01), clone 5F9
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PDCD2L |
| Gene Alias | MGC13096 |
| Gene Description | programmed cell death 2-like |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MGC13096 (AAH06146, 80 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 84306 |
| Clone Number | 5F9 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant MGC13096.