Ver mas grande
PCBD2 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00084105-B01P
Producto nuevo
PCBD2 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | PCBD2 |
| Gene Alias | DCOH2|DCOHM|PHS2 |
| Gene Description | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNVQITLTSHDCGELTKKDVKLAKFIEKAAASV |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | PCBD2 (NP_115527.2, 1 a.a. ~ 129 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 84105 |
Más información
Mouse polyclonal antibody raised against a full-length human PCBD2 protein.