Ver mas grande
CDADC1 monoclonal antibody (M01), clone 1A2
AB-H00081602-M01
Producto nuevo
CDADC1 monoclonal antibody (M01), clone 1A2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CDADC1 |
| Gene Alias | MGC150615|MGC41774|MGC57136|NYD-SP15|bA103J18.1 |
| Gene Description | cytidine and dCMP deaminase domain containing 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab |
| Immunogen Prot. Seq | KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CDADC1 (NP_112173, 423 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 81602 |
| Clone Number | 1A2 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CDADC1.