Ver mas grande
EFHD1 monoclonal antibody (M05), clone 1H7
AB-H00080303-M05
Producto nuevo
EFHD1 monoclonal antibody (M05), clone 1H7
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | EFHD1 |
| Gene Alias | DKFZp781H0842|FLJ13612|MST133|MSTP133|PP3051 |
| Gene Description | EF-hand domain family, member D1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,ELISA,IF |
| Immunogen Prot. Seq | GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 80303 |
| Clone Number | 1H7 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant EFHD1.