Ver mas grande
CCL17 polyclonal antibody (A01)
AB-H00006361-A01
Producto nuevo
CCL17 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | CCL17 |
| Gene Alias | A-152E5.3|ABCD-2|MGC138271|MGC138273|SCYA17|TARC |
| Gene Description | chemokine (C-C motif) ligand 17 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CCL17 (NP_002978, 24 a.a. ~ 94 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 6361 |
Más información
Mouse polyclonal antibody raised against a partial recombinant CCL17.