CFAP47,CHDC2
  • CFAP47,CHDC2

Anti-CFAP47 Antibody 100ul

Ref: AN-HPA044633-100ul
Anti-CFAP47

Información del producto

Polyclonal Antibody against Human CFAP47, Gene description: cilia and flagella associated protein 47, Alternative Gene Names: CHDC2, CXorf22, CXorf30, CXorf59, FLJ36601, MGC34831, RP13-11B7.1, Validated applications: IHC, Uniprot ID: Q6ZTR5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CFAP47
Gene Description cilia and flagella associated protein 47
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSM
Immunogen LQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CHDC2, CXorf22, CXorf30, CXorf59, FLJ36601, MGC34831, RP13-11B7.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZTR5
HTS Code 3002150000
Gene ID 286464
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CFAP47 Antibody 100ul

Anti-CFAP47 Antibody 100ul