View larger
Mouse monoclonal antibody raised against a partial recombinant FAS.
AB-MAB1301-M04
New product
FAS monoclonal antibody (M04), clone 7G3
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FAS |
| Gene Alias | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6 |
| Gene Description | Fas (TNF receptor superfamily, member 6) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | ESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FAS (AAH12479.1, 211 a.a. ~ 320 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 355 |
| Clone Number | 7G3 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant FAS.