MAFA monoclonal antibody (M01), clone 2F1 View larger

Mouse monoclonal antibody raised against a partial recombinant MAFA.

AB-H00389692-M01

New product

MAFA monoclonal antibody (M01), clone 2F1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name MAFA
Gene Alias RIPE3b1|hMafA
Gene Description v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAFA (NP_963883, 222 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 389692
Clone Number 2F1
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant MAFA.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant MAFA.

Mouse monoclonal antibody raised against a partial recombinant MAFA.