RAB7B monoclonal antibody (M02), clone 1C3 View larger

Mouse monoclonal antibody raised against a partial recombinant RAB7B.

AB-H00338382-M02

New product

RAB7B monoclonal antibody (M02), clone 1C3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name RAB7B
Gene Alias MGC16212|MGC9726|RAB7
Gene Description RAB7B, member RAS oncogene family
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 338382
Clone Number 1C3
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant RAB7B.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant RAB7B.

Mouse monoclonal antibody raised against a partial recombinant RAB7B.