View larger
Mouse polyclonal antibody raised against a full-length human NAP1L5 protein.
AB-H00266812-B03P
New product
NAP1L5 MaxPab mouse polyclonal antibody (B03P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | NAP1L5 |
| Gene Alias | DRLM |
| Gene Description | nucleosome assembly protein 1-like 5 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NAP1L5 (NP_715638.1, 1 a.a. ~ 182 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 266812 |
More info
Mouse polyclonal antibody raised against a full-length human NAP1L5 protein.