CCDC108 purified MaxPab mouse polyclonal antibody (B01P)
  • CCDC108 purified MaxPab mouse polyclonal antibody (B01P)

CCDC108 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00255101-B01P
CCDC108 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCDC108 protein.
Información adicional
Size 50 ug
Gene Name CCDC108
Gene Alias DKFZp434O0527|MGC35338
Gene Description coiled-coil domain containing 108
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTLHCAFQPTHPIICFRRVACLIHHQDPLFLDLMGTCHSDSTKPAILKPQHLTWYRTHLARGLTLYPPDILDAMLKEKKLAQDQNGALMIPIQDLEDMPAPQYPYIPPMTEFFFDGTSDITIFPPPISVEPVEVDFGACPGPEAPNPVPLCLMNHTKGKIMVVWTRRSDCPFWVTPESCDVPPLKSMAMRLHFQPPHPNCLYTVELEAFAIYKVCARNEREECGVSARSLSGLVGWQEVTEGSFRLHPLRARLSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCDC108 (AAH47637.1, 1 a.a. ~ 271 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 255101

Enviar uma mensagem


CCDC108 purified MaxPab mouse polyclonal antibody (B01P)

CCDC108 purified MaxPab mouse polyclonal antibody (B01P)