View larger
Mouse monoclonal antibody raised against a partial recombinant CNTN4.
AB-H00152330-M06
New product
CNTN4 monoclonal antibody (M06), clone 4B10
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CNTN4 |
| Gene Alias | AXCAM|BIG-2|CNTN4A|MGC33615 |
| Gene Description | contactin 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | EPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CNTN4 (NP_783200.1, 800 a.a. ~ 898 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 152330 |
| Clone Number | 4B10 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant CNTN4.