CCBE1 purified MaxPab mouse polyclonal antibody (B01P)
  • CCBE1 purified MaxPab mouse polyclonal antibody (B01P)

CCBE1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00147372-B01P
CCBE1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCBE1 protein.
Información adicional
Size 50 ug
Gene Name CCBE1
Gene Alias FLJ30681|MGC50861
Gene Description collagen and calcium binding EGF domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCBE1 (AAH46645, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 147372

Enviar uma mensagem


CCBE1 purified MaxPab mouse polyclonal antibody (B01P)

CCBE1 purified MaxPab mouse polyclonal antibody (B01P)