View larger
Mouse monoclonal antibody raised against a full length recombinant GSC.
AB-H00145258-M14
New product
GSC monoclonal antibody (M14), clone 3G6
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | GSC |
| Gene Alias | - |
| Gene Description | goosecoid homeobox |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P,ELISA |
| Immunogen Prot. Seq | LGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GSC (NP_776248, 78 a.a. ~ 186 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 145258 |
| Clone Number | 3G6 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant GSC.