View larger
Mouse polyclonal antibody raised against a full-length human IRAK1BP1 protein.
AB-H00134728-B01P
New product
IRAK1BP1 purified MaxPab mouse polyclonal antibody (B01P)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | IRAK1BP1 |
| Gene Alias | AIP70|MGC138458|MGC138460|SIMPL |
| Gene Description | interleukin-1 receptor-associated kinase 1 binding protein 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IF |
| Immunogen Prot. Seq | MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEK |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | IRAK1BP1 (NP_001010844.1, 1 a.a. ~ 260 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 134728 |
More info
Mouse polyclonal antibody raised against a full-length human IRAK1BP1 protein.