GRK7 monoclonal antibody (M03), clone 4C6 View larger

Mouse monoclonal antibody raised against a partial recombinant GRK7.

AB-H00131890-M03

New product

GRK7 monoclonal antibody (M03), clone 4C6

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name GRK7
Gene Alias GPRK7
Gene Description G protein-coupled receptor kinase 7
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLCEQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRK7 (NP_631948, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 131890
Clone Number 4C6
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant GRK7.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant GRK7.

Mouse monoclonal antibody raised against a partial recombinant GRK7.