OSR1 monoclonal antibody (M10), clone 1G9 View larger

Mouse monoclonal antibody raised against a partial recombinant OSR1.

AB-H00130497-M10

New product

OSR1 monoclonal antibody (M10), clone 1G9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name OSR1
Gene Alias ODD
Gene Description odd-skipped related 1 (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OSR1 (NP_660303, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 130497
Clone Number 1G9
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant OSR1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant OSR1.

Mouse monoclonal antibody raised against a partial recombinant OSR1.