KLHDC3 polyclonal antibody (A02) View larger

Mouse polyclonal antibody raised against a full-length recombinant KLHDC3.

AB-H00116138-A02

New product

KLHDC3 polyclonal antibody (A02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 uL
Gene Name KLHDC3
Gene Alias PEAS|RP1-20C7.3|dJ20C7.3|hPEAS
Gene Description kelch domain containing 3
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDTQPSSSTTQSSFGAGGMTPKGPAMCSMPLTSADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNWHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLHDC3 (AAH45612, 1 a.a. ~ 266 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 116138

More info

Mouse polyclonal antibody raised against a full-length recombinant KLHDC3.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length recombinant KLHDC3.

Mouse polyclonal antibody raised against a full-length recombinant KLHDC3.