CTHRC1 monoclonal antibody (M05), clone 1G12 View larger

Mouse monoclonal antibody raised against a partial recombinant CTHRC1.

AB-H00115908-M05

New product

CTHRC1 monoclonal antibody (M05), clone 1G12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CTHRC1
Gene Alias -
Gene Description collagen triple helix repeat containing 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTHRC1 (NP_612464, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115908
Clone Number 1G12
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant CTHRC1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant CTHRC1.

Mouse monoclonal antibody raised against a partial recombinant CTHRC1.