AB-H00083852-M22A
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 200 uL |
Gene Name | SETDB2 |
Gene Alias | C13orf4|CLLD8|CLLL8|DKFZp586I0123|DKFZp761J1217|KMT1F |
Gene Description | SET domain, bifurcated 2 |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA |
Immunogen Prot. Seq | KNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | SETDB2 (NP_114121.1, 620 a.a. ~ 719 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In ascites fluid |
Gene ID | 83852 |
Clone Number | 1H3 |
Iso type | IgG2a Kappa |