CCM2 polyclonal antibody (A01)
  • CCM2 polyclonal antibody (A01)

CCM2 polyclonal antibody (A01)

Ref: AB-H00083605-A01
CCM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CCM2.
Información adicional
Size 50 uL
Gene Name CCM2
Gene Alias C7orf22|MGC4067|MGC4607|MGC74868|PP10187
Gene Description cerebral cavernous malformation 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCM2 (NP_113631, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 83605

Enviar uma mensagem


CCM2 polyclonal antibody (A01)

CCM2 polyclonal antibody (A01)