SFXN3 monoclonal antibody (M01), clone 4A3 View larger

Mouse monoclonal antibody raised against a partial recombinant SFXN3.

AB-H00081855-M01

New product

SFXN3 monoclonal antibody (M01), clone 4A3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SFXN3
Gene Alias BA108L7.2|SFX3
Gene Description sideroflexin 3
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFXN3 (AAH00124.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 81855
Clone Number 4A3
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SFXN3.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SFXN3.

Mouse monoclonal antibody raised against a partial recombinant SFXN3.