CCL25 polyclonal antibody (A01)
  • CCL25 polyclonal antibody (A01)

CCL25 polyclonal antibody (A01)

Ref: AB-H00006370-A01
CCL25 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CCL25.
Información adicional
Size 50 uL
Gene Name CCL25
Gene Alias Ckb15|MGC150327|SCYA25|TECK
Gene Description chemokine (C-C motif) ligand 25
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL25 (NP_005615, 24 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6370

Enviar uma mensagem


CCL25 polyclonal antibody (A01)

CCL25 polyclonal antibody (A01)