CCL19 monoclonal antibody (M03A), clone 3E9
  • CCL19 monoclonal antibody (M03A), clone 3E9

CCL19 monoclonal antibody (M03A), clone 3E9

Ref: AB-H00006363-M03A
CCL19 monoclonal antibody (M03A), clone 3E9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CCL19.
Información adicional
Size 200 uL
Gene Name CCL19
Gene Alias CKb11|ELC|MGC34433|MIP-3b|MIP3B|SCYA19
Gene Description chemokine (C-C motif) ligand 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL19 (AAH27968, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6363
Clone Number 3E9
Iso type IgM Kappa

Enviar uma mensagem


CCL19 monoclonal antibody (M03A), clone 3E9

CCL19 monoclonal antibody (M03A), clone 3E9