CCL15 monoclonal antibody (M02), clone 4G10
  • CCL15 monoclonal antibody (M02), clone 4G10

CCL15 monoclonal antibody (M02), clone 4G10

Ref: AB-H00006359-M02
CCL15 monoclonal antibody (M02), clone 4G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCL15.
Información adicional
Size 100 ug
Gene Name CCL15
Gene Alias HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15
Gene Description chemokine (C-C motif) ligand 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6359
Clone Number 4G10
Iso type IgG2b Kappa

Enviar uma mensagem


CCL15 monoclonal antibody (M02), clone 4G10

CCL15 monoclonal antibody (M02), clone 4G10