CCL15 polyclonal antibody (A01)
  • CCL15 polyclonal antibody (A01)

CCL15 polyclonal antibody (A01)

Ref: AB-H00006359-A01
CCL15 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CCL15.
Información adicional
Size 50 uL
Gene Name CCL15
Gene Alias HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15
Gene Description chemokine (C-C motif) ligand 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6359

Enviar uma mensagem


CCL15 polyclonal antibody (A01)

CCL15 polyclonal antibody (A01)