CCL13 monoclonal antibody (M03), clone S2
  • CCL13 monoclonal antibody (M03), clone S2

CCL13 monoclonal antibody (M03), clone S2

Ref: AB-H00006357-M03
CCL13 monoclonal antibody (M03), clone S2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CCL13.
Información adicional
Size 100 ug
Gene Name CCL13
Gene Alias CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1
Gene Description chemokine (C-C motif) ligand 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL13 (AAH08621, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6357
Clone Number S2
Iso type IgG2a Kappa

Enviar uma mensagem


CCL13 monoclonal antibody (M03), clone S2

CCL13 monoclonal antibody (M03), clone S2