CCL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCL1 purified MaxPab rabbit polyclonal antibody (D01P)

CCL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006346-D01P
CCL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCL1 protein.
Información adicional
Size 100 ug
Gene Name CCL1
Gene Alias I-309|P500|SCYA1|SISe|TCA3
Gene Description chemokine (C-C motif) ligand 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL1 (NP_002972.1, 1 a.a. ~ 96 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6346

Enviar uma mensagem


CCL1 purified MaxPab rabbit polyclonal antibody (D01P)

CCL1 purified MaxPab rabbit polyclonal antibody (D01P)