CCNE1 polyclonal antibody
  • CCNE1 polyclonal antibody

CCNE1 polyclonal antibody

Ref: AB-PAB30542
CCNE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CCNE1.
Información adicional
Size 100 uL
Gene Name CCNE1
Gene Alias CCNE
Gene Description cyclin E1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CCNE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 898
Iso type IgG

Enviar un mensaje


CCNE1 polyclonal antibody

CCNE1 polyclonal antibody