ANXA8 purified MaxPab mouse polyclonal antibody (B01P)
  • ANXA8 purified MaxPab mouse polyclonal antibody (B01P)

ANXA8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00653145-B01P
ANXA8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANXA8 protein.
Información adicional
Size 50 ug
Gene Name ANXA8
Gene Alias ANX8|FLJ53095
Gene Description annexin A8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANXA8 (NP_001035173.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 653145

Enviar un mensaje


ANXA8 purified MaxPab mouse polyclonal antibody (B01P)

ANXA8 purified MaxPab mouse polyclonal antibody (B01P)