CCL4L2 monoclonal antibody (M01), clone 4G8
  • CCL4L2 monoclonal antibody (M01), clone 4G8

CCL4L2 monoclonal antibody (M01), clone 4G8

Ref: AB-H00388372-M01
CCL4L2 monoclonal antibody (M01), clone 4G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCL4L2.
Información adicional
Size 100 ug
Gene Name CCL4L2
Gene Alias AT744.2|CCL4L|SCYA4L
Gene Description chemokine (C-C motif) ligand 4-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL4L2 (NP_996890, 28 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 388372
Clone Number 4G8
Iso type IgG2a Kappa

Enviar un mensaje


CCL4L2 monoclonal antibody (M01), clone 4G8

CCL4L2 monoclonal antibody (M01), clone 4G8