CCDC5 monoclonal antibody (M01), clone 1E3
  • CCDC5 monoclonal antibody (M01), clone 1E3

CCDC5 monoclonal antibody (M01), clone 1E3

Ref: AB-H00115106-M01
CCDC5 monoclonal antibody (M01), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCDC5.
Información adicional
Size 100 ug
Gene Name CCDC5
Gene Alias FLJ21094|FLJ40084|HEI-C|HsT1461
Gene Description coiled-coil domain containing 5 (spindle associated)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RQNMDFLKAKSEEFRFGIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCDC5 (NP_612452.1, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115106
Clone Number 1E3
Iso type IgG2a Kappa

Enviar un mensaje


CCDC5 monoclonal antibody (M01), clone 1E3

CCDC5 monoclonal antibody (M01), clone 1E3