CCNB3 polyclonal antibody (A01)
  • CCNB3 polyclonal antibody (A01)

CCNB3 polyclonal antibody (A01)

Ref: AB-H00085417-A01
CCNB3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CCNB3.
Información adicional
Size 50 uL
Gene Name CCNB3
Gene Alias -
Gene Description cyclin B3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNB3 (NP_149020, 1296 a.a. ~ 1395 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 85417

Enviar un mensaje


CCNB3 polyclonal antibody (A01)

CCNB3 polyclonal antibody (A01)