CCDC6 monoclonal antibody (M03), clone 5D11
  • CCDC6 monoclonal antibody (M03), clone 5D11

CCDC6 monoclonal antibody (M03), clone 5D11

Ref: AB-H00008030-M03
CCDC6 monoclonal antibody (M03), clone 5D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCDC6.
Información adicional
Size 100 ug
Gene Name CCDC6
Gene Alias D10S170|FLJ32286|H4|PTC|TPC|TST1
Gene Description coiled-coil domain containing 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCDC6 (NP_005427, 375 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8030
Clone Number 5D11
Iso type IgG1 Kappa

Enviar un mensaje


CCDC6 monoclonal antibody (M03), clone 5D11

CCDC6 monoclonal antibody (M03), clone 5D11