CCL24 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCL24 purified MaxPab rabbit polyclonal antibody (D01P)

CCL24 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006369-D01P
CCL24 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCL24 protein.
Información adicional
Size 100 ug
Gene Name CCL24
Gene Alias Ckb-6|MPIF-2|MPIF2|SCYA24
Gene Description chemokine (C-C motif) ligand 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL24 (NP_002982.2, 1 a.a. ~ 119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6369

Enviar un mensaje


CCL24 purified MaxPab rabbit polyclonal antibody (D01P)

CCL24 purified MaxPab rabbit polyclonal antibody (D01P)