CCL21 purified MaxPab mouse polyclonal antibody (B01P)
  • CCL21 purified MaxPab mouse polyclonal antibody (B01P)

CCL21 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006366-B01P
CCL21 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCL21 protein.
Información adicional
Size 50 ug
Gene Name CCL21
Gene Alias 6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4
Gene Description chemokine (C-C motif) ligand 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL21 (NP_002980.1, 1 a.a. ~ 134 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6366

Enviar un mensaje


CCL21 purified MaxPab mouse polyclonal antibody (B01P)

CCL21 purified MaxPab mouse polyclonal antibody (B01P)