CCL17 monoclonal antibody (M02), clone 1F11
  • CCL17 monoclonal antibody (M02), clone 1F11

CCL17 monoclonal antibody (M02), clone 1F11

Ref: AB-H00006361-M02
CCL17 monoclonal antibody (M02), clone 1F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCL17.
Información adicional
Size 100 ug
Gene Name CCL17
Gene Alias A-152E5.3|ABCD-2|MGC138271|MGC138273|SCYA17|TARC
Gene Description chemokine (C-C motif) ligand 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL17 (NP_002978, 24 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6361
Clone Number 1F11
Iso type IgG2b Kappa

Enviar un mensaje


CCL17 monoclonal antibody (M02), clone 1F11

CCL17 monoclonal antibody (M02), clone 1F11