CCL15 MaxPab rabbit polyclonal antibody (D01)
  • CCL15 MaxPab rabbit polyclonal antibody (D01)

CCL15 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006359-D01
CCL15 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCL15 protein.
Información adicional
Size 100 uL
Gene Name CCL15
Gene Alias HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15
Gene Description chemokine (C-C motif) ligand 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL15 (NP_004158.2, 1 a.a. ~ 113 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6359

Enviar un mensaje


CCL15 MaxPab rabbit polyclonal antibody (D01)

CCL15 MaxPab rabbit polyclonal antibody (D01)