CCL14 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCL14 purified MaxPab rabbit polyclonal antibody (D01P)

CCL14 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006358-D01P
CCL14 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCL14 protein.
Información adicional
Size 100 ug
Gene Name CCL14
Gene Alias CC-1|CC-3|CKb1|HCC-1|HCC-3|MCIF|NCC-2|NCC2|SCYA14|SCYL2|SY14
Gene Description chemokine (C-C motif) ligand 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL14 (NP_004157.1, 1 a.a. ~ 93 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6358

Enviar un mensaje


CCL14 purified MaxPab rabbit polyclonal antibody (D01P)

CCL14 purified MaxPab rabbit polyclonal antibody (D01P)