CCL13 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCL13 purified MaxPab rabbit polyclonal antibody (D01P)

CCL13 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006357-D01P
CCL13 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCL13 protein.
Información adicional
Size 100 ug
Gene Name CCL13
Gene Alias CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1
Gene Description chemokine (C-C motif) ligand 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL13 (NP_005399.1, 1 a.a. ~ 98 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6357

Enviar un mensaje


CCL13 purified MaxPab rabbit polyclonal antibody (D01P)

CCL13 purified MaxPab rabbit polyclonal antibody (D01P)